General Information

  • ID:  hor002878
  • Uniprot ID:  Q86MA7
  • Protein name:  IREFV-amide
  • Gene name:  NA
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed abundantly in the abdominal ganglion, much less in the pedal and cerebral ganglia, and rarely in the buccal and pleural ganglia.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  IREFV
  • Length:  5(815-819)
  • Propeptide:  MSSQLLICSVFVLFTFGPNSFPSCLAQEQAGNSDATQLSADAKAPESAKDKSGDVQNDGTKSVRSKRDLEIDFGSGDVQKRAREFVGKRAAPPVFQTPLVQDKISGFIPSETESPVIGEFAFPGSVFMDDEEALGAEEEPMDDEDLEFYKRPRQFVGKRGIDDYLLQEKLKDFIEKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKRPRQFVGKREADPSF
  • Signal peptide:  MSSQLLICSVFVLFTFGPNS
  • Modification:  T5 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PRQFV-amide may act as a modulator within the feeding system as well as in other systems of Aplysia.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q86MA7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002878_AF2.pdbhor002878_ESM.pdb

Physical Information

Mass: 73431 Formula: C31H50N8O8
Absent amino acids: ACDGHKLMNPQSTWY Common amino acids: EFIRV
pI: 6.41 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 3
Hydrophobicity: 70 Boman Index: -979
Half-Life / Aliphatic Index: 20 hour Aliphatic Index: 136
Instability Index: 800 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12612009
  • Title:  PRQFVamide, a novel pentapeptide identified from the CNS and gut of Aplysia.